DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and snk

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:281 Identity:83/281 - (29%)
Similarity:132/281 - (46%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FLEENCGVVPRLSYKIINGTPARLGRYPWMAFL---------HTPTYFLCAGSLINQWFVLTSAH 82
            |..:.|  ||.:.. |:.|||.|.|.:|.||.|         .....:.|.|:|:::.:|||:||
  Fly   174 FSGKQC--VPSVPL-IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAH 235

  Fly    83 CI------EDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLR 141
            |.      .|.|.|.||            :.|......|:..:.::..|..|....:.:||.:|:
  Fly   236 CATSGSKPPDMVRLGAR------------QLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLK 288

  Fly   142 LERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDC 206
            |.|||:::..::|.|::     ||...||....|.|||.|.. |..||: .|.:::|...|:..|
  Fly   289 LTRRVKFSEQVRPACLW-----QLPELQIPTVVAAGWGRTEF-LGAKSN-ALRQVDLDVVPQMTC 346

  Fly   207 ARIFK------QNFLSGQICAGNDDG--NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCS 263
            .:|::      :..:.||.|||...|  :.|:||||||....:..:....|| :||.||. :.|:
  Fly   347 KQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSFG-KFCA 409

  Fly   264 KVS---ILTDVVRYGRWIKKV 281
            ..:   :.|.:..|..||:|:
  Fly   410 APNAPGVYTRLYSYLDWIEKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 76/262 (29%)
Tryp_SPc 42..281 CDD:238113 78/264 (30%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 78/264 (30%)
Tryp_SPc 186..427 CDD:214473 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.