DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG13318

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:255 Identity:61/255 - (23%)
Similarity:100/255 - (39%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ARLGRYPWM-AFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELI---ARLGENNRDNDIDCENN 108
            |..|.|||. |.|.|...:|..|:||....|||:||.:. ::.|.   .||||      .|..:.
  Fly   169 ASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKVY-NLGLTYFKVRLGE------WDAAST 226

  Fly   109 RCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYH--IQPICIFHHRRMQLVVDQIT 171
            ......|:..:..::.:..::|.:..||:.:|:|...|..|..  :..:|:    .....|.|..
  Fly   227 SEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL----PTTSFVGQRC 287

  Fly   172 WFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQ--------ICAGNDDG-N 227
            |  ..|||............:..::::...|..:|....:...|...        ||||.:.| :
  Fly   288 W--VAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKD 350

  Fly   228 LCRGDSGGP-----QGRYVLIFGMKRFVQMGIASFTYENCSKV---SILTDVVRYGRWIK 279
            .|.||.|.|     .|.:.:: |:   |..||      .|::.   .:..:|..|..||:
  Fly   351 ACTGDGGSPLVCTSNGVWYVV-GL---VAWGI------GCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 59/252 (23%)
Tryp_SPc 42..281 CDD:238113 61/255 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 61/255 (24%)
Tryp_SPc 169..399 CDD:214473 59/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.