DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and MP1

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:305 Identity:88/305 - (28%)
Similarity:133/305 - (43%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL-----------HTPTYFLCAGSLINQW 75
            |:..:.:..|||  .....:::.|.......:||||.:           |      |.|||||..
  Fly   120 GTKLLPMAPNCG--ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH------CGGSLINHR 176

  Fly    76 FVLTSAHC---IEDDVELI-ARLGENNRDNDIDC---ENNR--CLEATQEYNVDMLFKHRLY--D 129
            :|||:|||   |..|.||. .||||.:...:.||   :|.|  |.|...:|.|:....|..|  :
  Fly   177 YVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGN 241

  Fly   130 PKDFSNDIGMLRLERRVEYTYHIQPIC----------IFHHRRMQLVVDQITWFKATGWGLTSTD 184
            .:|..|||.:|||...|:|:..|.|:|          ||..|::.:          .|||.|.|:
  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVV----------AGWGRTETN 296

  Fly   185 LNTKSSRVLMELNLYRRPRNDCARIF---KQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIF- 244
            .   :|.:.::..|...|.::|.:.:   ::...:.|:|||..:| :.||||||||     |:. 
  Fly   297 F---TSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGP-----LLLE 353

  Fly   245 ----GMKRFVQMGIASFTYENCSK---VSILTDVVRYGRWIKKVV 282
                |...:...|:.|:....|..   ..:.|.|..|..||:..|
  Fly   354 DYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 81/280 (29%)
Tryp_SPc 42..281 CDD:238113 83/282 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 81/280 (29%)
Tryp_SPc 138..397 CDD:238113 83/282 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463504
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.