DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG18223

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:295 Identity:70/295 - (23%)
Similarity:122/295 - (41%) Gaps:88/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIEDD 87
            ||..|.:|...|:.:....|.:..|.:         |....:| |.|.:|::.::||||||..|.
  Fly    45 SSPYFDKEKTLVLAKYVVSIRSRRPHK---------LFGDNHF-CGGVIISRTYILTSAHCAMDK 99

  Fly    88 VELIAR-------LGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDF----SNDIGMLR 141
            .:::.|       .|..||           |::.:..:::|..| :::.|..|    :|:|.::.
  Fly   100 RKIVHRSRVLVVVAGTTNR-----------LKSRKGLSLNMEVK-KIFVPDKFTVFNTNNIALMM 152

  Fly   142 LERRVEYTYHIQPICIFHHRRMQLVVDQITW-------FKATGWG-------LTSTDLNTKSSRV 192
            |.:::       |:    ...:..|::..|.       :...|||       |.|.         
  Fly   153 LAKKL-------PL----DNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASD--------- 197

  Fly   193 LMELNLYRRPRNDCAR---IFKQNFLSGQICAGN----DDGNLCRGDSGGPQGRYVLIFGMKRFV 250
            ::.:::...||:.|.:   |||:..:    ||||    .|.|.|.||:|.|     |||....| 
  Fly   198 ILHIDVELLPRDICEKKVHIFKEEMM----CAGNLNNTMDENPCAGDTGSP-----LIFNETVF- 252

  Fly   251 QMGIASFTYENCSKV--SILTDVVRYGRWIKKVVD 283
              |:.|:.....||.  ||.|:|..:..||..:::
  Fly   253 --GVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 63/270 (23%)
Tryp_SPc 42..281 CDD:238113 65/272 (24%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/276 (24%)
Tryp_SPc 60..280 CDD:214473 63/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.