DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG7542

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:116/275 - (42%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VFLEENCGVVPRLS----YKIINGTPARLGRYPWMAFLHT-----PTYFLCAGSLINQWFVLTSA 81
            |.|..:|..||.|:    | |.||.||.:|::|:.|.|:.     .|:  |.|:||:.::::|:|
  Fly     8 VLLVGSCTAVPLLTDVEPY-ITNGEPAEVGQFPYQAGLNVSFGNWSTW--CGGTLISHYWIITAA 69

  Fly    82 HCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDM--LFKHRLYDPKDFSNDIGMLRLER 144
            ||::....:...||..|..::.:       |..:...|:.  :..|..|......|||.::||..
  Fly    70 HCMDGAESVTVYLGAINIGDESE-------EGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPA 127

  Fly   145 RVEYTYHIQPICIFHHRRMQL-VVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCAR 208
            .|.:|..|:...:......|. ..:.|..| |:|||..| |.:...|.||..:.:...|.:.|..
  Fly   128 FVGFTDRIRAASLPRRLNGQFPTYESIRAF-ASGWGRES-DASDSVSPVLRYVEMPIMPHSLCRM 190

  Fly   209 IFKQNFLSGQICAGNDDG-NLCRGDSGGP----QGRYVLIFGMKRF-----VQMGIASFTYENCS 263
            .:........||.....| :.|.||||||    ||....:.|...|     .|:|..        
  Fly   191 YWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFP-------- 247

  Fly   264 KVSILTDVVRYGRWI 278
              ::.|.:..|..||
  Fly   248 --AVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 65/254 (26%)
Tryp_SPc 42..281 CDD:238113 67/255 (26%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 67/255 (26%)
Tryp_SPc 27..260 CDD:214473 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.