DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Jon74E

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:296 Identity:76/296 - (25%)
Similarity:126/296 - (42%) Gaps:49/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEMKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLH----TPTY 64
            :::.||:.:|.:.   |.|.|...|:...|:..|    |..|..||..::|:...|.    ...|
  Fly     1 MQISTILVFLLIL---VQGRSISCLDMGHGIGGR----IAGGELARANQFPYQVGLSIEEPNDMY 58

  Fly    65 FLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQ-EYNVDMLFKHRLY 128
            ..|..|||:..::||:|||:|..|.:...||     ..:.....:.:.:|. |.::     |..:
  Fly    59 CWCGASLISDRYLLTAAHCVEKAVAITYYLG-----GVLRLAPRQLIRSTNPEVHL-----HPDW 113

  Fly   129 DPKDFSNDIGMLRLERRVEYTYHIQPI---CIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSS 190
            :.:...|||.::||.........|:||   .:...|.....|..|    |:|||    .:|.:|:
  Fly   114 NCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI----ASGWG----RMNDEST 170

  Fly   191 RVLMELN-LYR--RPRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFG---MKR 248
            .:...|. :||  ....||...: .|.....||.....| :.|.||||||     |::.   ...
  Fly   171 AISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDTTGGKSTCTGDSGGP-----LVYSDPVQNA 229

  Fly   249 FVQMGIASFTYEN-CSK--VSILTDVVRYGRWIKKV 281
            .:.:|:.|:..:: |:|  .|:.|.:..|..||.:|
  Fly   230 DILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 64/254 (25%)
Tryp_SPc 42..281 CDD:238113 66/256 (26%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.