DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG11529

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:115/265 - (43%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PRLSYKIINGTPARLGRYPWMAFLHTPTYF----LCAGSLINQWFVLTSAHCIEDDVELIARLGE 96
            |..||.:......|:.::|:...|.....:    ||.|:|:::.::||:.||..........||.
  Fly    24 PTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGT 88

  Fly    97 NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICI---F 158
            .:.: |.:......|.:.:      ...|..::|:..:|||.:::|.:.|.:|..|||..:   :
  Fly    89 KSVE-DTEVSGGLVLRSNK------FIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRY 146

  Fly   159 HHRRMQLVVDQITWFK--ATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICA 221
            .|       ||.....  |:||| ...::....|....||.:....  :||:.: ....||.|||
  Fly   147 RH-------DQFAGMSVVASGWG-AMVEMTNSDSMQYTELKVISNA--ECAQEY-DVVTSGVICA 200

  Fly   222 -GNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSI---LTDVVRYGRWIKKVV 282
             |..|..:|.||||||     |:....:.| :||.||...:..:.:|   .|.|..|..||:..:
  Fly   201 KGLKDETVCTGDSGGP-----LVLKDTQIV-VGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259

  Fly   283 DWYGR 287
            ..:|:
  Fly   260 GSHGQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 62/249 (25%)
Tryp_SPc 42..281 CDD:238113 64/251 (25%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 64/244 (26%)
Tryp_SPc 37..255 CDD:214473 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.