DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33460

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:285 Identity:84/285 - (29%)
Similarity:139/285 - (48%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAYLALFVLGVHGS--SSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLI 72
            |:.||.::|.::..  |:.:|.|.||:: |..:....|        ||.|.|||.....|||:||
  Fly     7 ISLLASYMLVIYSDSVSANYLYEQCGLM-REEFSTSLG--------PWTALLHTDGSIFCAGTLI 62

  Fly    73 NQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDI 137
            ...|:||:|.||..:...: ||||..|..:         |..:::.|.....:||::.:..:|:|
  Fly    63 TDVFILTAASCIRPNAVKV-RLGEFGRYPN---------ELPEDHLVHYFLMYRLFNNESLANNI 117

  Fly   138 GMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATG--WGLTSTDLNTKSSRVLMELNLYR 200
            |:|:|.:||:.|.:|.|:||..:.:.|    |::..:..|  |   ..|.|...::.|..:.:..
  Fly   118 GLLKLTKRVQITDYIMPVCIVLNPQNQ----QLSTMRFIGNAW---MEDSNVSLTKELRPIVIQS 175

  Fly   201 RPRNDCARIFKQNFLSGQICAGNDDGNL--CRGDSGG---PQGRYVLIFGMKRFVQMGIASFTYE 260
            :|:. |..:    .|..|.|||: .|||  |.|.:|.   ...||:   ...|.:|.|||:....
  Fly   176 KPKM-CTNL----DLYTQFCAGH-QGNLRSCDGLTGSALIQNSRYM---NKYRHIQFGIATVNDM 231

  Fly   261 NCSKVSILTDVVRYGRWIKKVVDWY 285
            :|.:....|||:::..||:.||..:
  Fly   232 DCEESQGYTDVLKFYWWIQDVVSLF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 70/243 (29%)
Tryp_SPc 42..281 CDD:238113 72/245 (29%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 71/233 (30%)
Tryp_SPc 44..249 CDD:214473 69/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.