DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33465

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:280 Identity:90/280 - (32%)
Similarity:135/280 - (48%) Gaps:31/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFV 77
            |||..|.:....:..|::.|. .|:.| :.||.........||||.::....|:|.|:|:::.||
  Fly     7 LALIGLVLCQGLAQLLDKKCH-DPKTS-ENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFV 69

  Fly    78 LTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRL 142
            ||:|.||..|.:|....|..|:..|.....|     .::|.|.:..:|..:.|.:..||||:|||
  Fly    70 LTAASCISKDSQLYVLFGMYNQYRDASQFFN-----NEQYGVAVALQHSNFRPNNGVNDIGLLRL 129

  Fly   143 ERRVEYTYHIQPICIFHHRRMQLVVDQIT------WFKATGWGLTSTDLNTKSSRVLMELNLYRR 201
            ...|.:..||:||||        ::|.:.      .|:..||....|:   .||:|...:.|.::
  Fly   130 YGEVTHYAHIRPICI--------ILDHVVKSAPFERFEGFGWQQQGTE---ASSQVRQTVYLSQK 183

  Fly   202 PRNDCAR---IFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRF-VQMGIASFTYENC 262
            ...:|.|   :...|  .||.||||.|.:.||.:||.|. .....:|:|.. ||:|:.|:..|.|
  Fly   184 KPFECHRNGQLLPIN--EGQFCAGNRDRSFCRSNSGSPL-TADFTYGVKNITVQVGLVSYGSELC 245

  Fly   263 SKVSILTDVVRYGRWIKKVV 282
            |..|:.||||.:..||...|
  Fly   246 SPTSVYTDVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 79/246 (32%)
Tryp_SPc 42..281 CDD:238113 81/248 (33%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 79/236 (33%)
Tryp_SPc 46..261 CDD:214473 77/233 (33%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463376
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.