DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG10469

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:125/266 - (46%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SYKIINGTPARLGRYPWMAFLHTPTYF--------LCAGSLINQWFVLTSAHCIEDDV----ELI 91
            |.:|:|||.|:..:.|:...|  ..||        :|.|::::..:::|:|||::|..    :::
  Fly    21 SLRIMNGTAAKAKQLPYQVGL--LCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVL 83

  Fly    92 ARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPIC 156
            ..:|:....:|.:...||      .|.:    .|:.:|.|..:|||.:::|.:::.:..:|||  
  Fly    84 IHVGKVKSFDDKEIVVNR------SYTI----VHKKFDRKTVTNDIALIKLPKKLTFNKYIQP-- 136

  Fly   157 IFHHRRMQLVVDQITWFKA--TGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIF--------K 211
                .::.......|..||  :|||||:..|   .|:||..:........:|.|.:        |
  Fly   137 ----AKLPSAKKTYTGRKAIISGWGLTTKQL---PSQVLQYIRAPIISNKECERQWNKQLGGKSK 194

  Fly   212 QNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKV---SILTDVVR 273
            :...:|.||..:..|..||||||||.   ||..|.:..|  ||.|..::...|:   .:.|.|..
  Fly   195 KVVHNGFICIDSKKGLPCRGDSGGPM---VLDDGSRTLV--GIVSHGFDGECKLKLPDVSTRVSS 254

  Fly   274 YGRWIK 279
            |.:|||
  Fly   255 YLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 69/261 (26%)
Tryp_SPc 42..281 CDD:238113 72/263 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 69/261 (26%)
Tryp_SPc 24..260 CDD:238113 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.