DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG10472

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:116/278 - (41%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL---HTPTYFLCAGSLINQWFVLTSA 81
            |||.:          :|  |.:|..|..|...::|:...|   .|.....|.|::|:..:::|:|
  Fly    37 VHGET----------LP--SGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAA 89

  Fly    82 HCIED-----DVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLR 141
            ||.:.     ||    .||.::|.|  ..|..:.:...:..||   ..|..:..:..:|||.:::
  Fly    90 HCTDSLTTGVDV----YLGAHDRTN--AKEEGQQIIFVETKNV---IVHEDWIAETITNDISLIK 145

  Fly   142 LERRVEYTYHIQPICIFHHRRMQLVVDQITWFK-----ATGWGLTSTDLNTKSSRVLMELNLYRR 201
            |...:|:..:|||      .::.:..|..:.:.     |:|||..| |..|.::.:|....:...
  Fly   146 LPVPIEFNKYIQP------AKLPVKSDSYSTYGGENAIASGWGKIS-DSATGATDILQYATVPIM 203

  Fly   202 PRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKV 265
            ..:.|:..:.....:..||.....| :.|.||||||   .||..|....:  |..||......:|
  Fly   204 NNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGP---LVLDDGSNTLI--GATSFGIALGCEV 263

  Fly   266 ---SILTDVVRYGRWIKK 280
               .:.|.:..|..||::
  Fly   264 GWPGVFTRITYYLDWIEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 60/253 (24%)
Tryp_SPc 42..281 CDD:238113 62/256 (24%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 60/253 (24%)
Tryp_SPc 47..282 CDD:238113 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.