DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG6592

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:254 Identity:67/254 - (26%)
Similarity:112/254 - (44%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KIINGTPARLGRYPWMA--FLHTPT-YFLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDND 102
            :|..|.......:|:..  .|..|. .:.|.||||:...|:|:|||::.....:..||.|...|.
  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186

  Fly   103 IDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICI----FHHR-- 161
            .:....|.:..::.:.:     :..::||...:||.::||...|.:...|.||.:    :.:|  
  Fly   187 KEKGQVRLMVPSENFQI-----YPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSF 246

  Fly   162 RMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQIC-AGNDD 225
            :.:|.:       |:|||..:|.::. .|.||..:.|.......|...|..::....|| :|.:.
  Fly   247 KNKLAI-------ASGWGRYATGVHA-ISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNA 303

  Fly   226 GNLCRGDSGGP---QGRYVLIFGMKRFVQMGIASF-TYENCSK--VSILTDVVRYGRWI 278
            .:.|.||||||   |.|:     .|:.|.:||.|| :...|.:  .:..|.|..|..||
  Fly   304 RSTCNGDSGGPLVLQRRH-----SKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 65/252 (26%)
Tryp_SPc 42..281 CDD:238113 67/253 (26%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 65/252 (26%)
Tryp_SPc 123..359 CDD:238113 67/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.