DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:105/260 - (40%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLSYKIINGTPARLGRYPWMAFLHTPT----YFLCAGSLINQWFVLTSAHCIEDDVELIARLGEN 97
            :::.:|.||.||..|:.|::..|....    .:.|.||:|...:|||:|||......:....|..
  Fly    32 KINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAV 96

  Fly    98 NRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRR 162
            .|...                   .|.|  ||..:..|||.::|       |.|:....:.:...
  Fly    97 WRQQP-------------------QFTH--YDTGNLHNDIALIR-------TPHVDFWSLVNKVE 133

  Fly   163 MQLVVDQIT-----WFKATGWGLTSTDLNTKSSRVLMELNLYRRPRND---CARIFKQNFL-SGQ 218
            :....|:..     |...:||| :|:|    ||.:...||......:|   |...:..::: |..
  Fly   134 LPRYDDRYNNFYGWWALLSGWG-SSSD----SSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNH 193

  Fly   219 IC-AGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASF-TYENCSKVSI--LTDVVRYGRWIK 279
            :| |..::...|.||||||   .||..|.:   |:||.|| :...|...|.  ||.|..|..||:
  Fly   194 LCYATPENKGSCSGDSGGP---LVLHDGNR---QVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252

  Fly   280  279
              Fly   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 67/253 (26%)
Tryp_SPc 42..281 CDD:238113 69/255 (27%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 67/253 (26%)
Tryp_SPc 37..254 CDD:238113 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.