DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG10477

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:119/290 - (41%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALFVLGVHGSSSVFLEENCGV-------VPRLSYKIINGTPARLGRYPW---MAFLHTPTYFLCA 68
            |:.||.:...|:..|.::..|       ||.:..:|.||..|...::|:   ::|..:...:.|.
  Fly     5 AVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCG 69

  Fly    69 GSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDF 133
            ||:|...:|||:|||.:....:....|...|.:         .:..::.:.....:|..|:....
  Fly    70 GSIIANTWVLTAAHCTKGASSVTIYYGSTVRTS---------AKLKKKVSSSKFVQHAGYNAATL 125

  Fly   134 SNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFK-----ATGWGLTSTDLNTKSSRVL 193
            .|||.:::.. .|.:|..|..|.      :..:....:.:.     |:|||.||      .|.:.
  Fly   126 RNDISLIKTP-SVTFTVSINKIA------LPAIASSYSTYAGQTAVASGWGRTS------DSSIA 177

  Fly   194 MELNL-YRR----PRNDCARIFKQNFL-SGQICAGN-DDGNLCRGDSGGPQGRYVLIFGMKRFVQ 251
            :..|| |.:    ....|.:.|..:.: ||.||..: :..:.|:||||||......:.|:..|| 
  Fly   178 VATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFV- 241

  Fly   252 MGIASFTYENCSK--VSILTDVVRYGRWIK 279
                  :.:.|.|  .:..|.|..|..|||
  Fly   242 ------SSKGCEKNAPAGFTRVTSYLDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 58/253 (23%)
Tryp_SPc 42..281 CDD:238113 61/255 (24%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 58/253 (23%)
Tryp_SPc 40..267 CDD:238113 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.