DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG15873

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:322 Identity:72/322 - (22%)
Similarity:117/322 - (36%) Gaps:104/322 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYK----IING----TPARLGRYPWMAFLHTP 62
            |:.:..:|.|.:      |:...:.:.||:..:|.:    :|:|    ...||.|:  :..:.|.
  Fly     1 MQILTVFLGLIL------STSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRH--VVSIRTK 57

  Fly    63 TY-------FLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVD 120
            .|       ..|:|.|::...|||:|||:.|                      |...:.....:.
  Fly    58 NYVRHRGDNHFCSGVLVSSRAVLTAAHCLTD----------------------RYKASMNPRGIR 100

  Fly   121 MLFKH----RLYDPKDF----------------SNDIGMLRLERRVEYTYH-IQPICIFHHRRMQ 164
            ::|.|    .:||..||                .||:.:|||..||:.:.| :.|:.:   |:..
  Fly   101 VVFGHITRLAVYDESDFRSVDRLVVHPEYERYKKNDLAILRLSERVQSSNHDVLPLLM---RKTA 162

  Fly   165 LVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNL- 228
            .|....|.. ..|||  ....:...|..|:.|::..||.:.|.:.:........:|......:: 
  Fly   163 NVTYGDTCI-TLGWG--QIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMN 224

  Fly   229 CRGDSGGP---QGR-YVLIFGMKRFVQMGIA--------SFTYENCSKVSILTDVVRYGRWI 278
            |.||.|||   :|. :.||.|     .||.|        ||.|              |..||
  Fly   225 CAGDMGGPLLCKGALFGLIGG-----HMGCAGGKAMKFLSFLY--------------YKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 63/285 (22%)
Tryp_SPc 42..281 CDD:238113 65/282 (23%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/248 (23%)
Tryp_SPc 59..250 CDD:238113 52/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.