DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG12133

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:286 Identity:88/286 - (30%)
Similarity:131/286 - (45%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYF-------LCAGSLINQWFVLTSAHCIEDDVE 89
            ||..|..|| |:.|..|:..::||...|....|.       :||||||...:|||:|||:..:..
  Fly    53 CGQSPPSSY-IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDF 116

  Fly    90 LIA--RLGENNRDNDID---CENNRCL--EATQEYNVDMLFKHRLYDPKD--FSNDIGMLRLERR 145
            .:|  ||||::.:||.|   ..|...:  .|..:.:||:...|..|..::  ..|||.:|||:.|
  Fly   117 YVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSR 181

  Fly   146 VEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIF 210
            |:||..|:||||:....:.....:...|:..|||  .:.|..||: ||.:..:.....::|...:
  Fly   182 VKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWG--DSGLQQKST-VLRQGTISGMSPDECLNRY 243

  Fly   211 KQNFLSG--QICA----GNDDGNLCRGDSGGP----QGRYVLIFGMKRFVQM--------GIASF 257
            ....:..  ||||    |.|.|   .||||.|    .||     |..:|..:        |.:|:
  Fly   244 PTLLVDKDIQICAMGWDGTDTG---LGDSGSPLMASVGR-----GADQFYYLAGITSYGGGPSSY 300

  Fly   258 TYENCSKVSILTDVVRYGRWIKKVVD 283
            .|    ..::.|....|..||||.::
  Fly   301 GY----GPAVYTKTSSYYEWIKKKIN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 79/270 (29%)
Tryp_SPc 42..281 CDD:238113 82/272 (30%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 82/272 (30%)
Tryp_SPc 62..317 CDD:214473 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.