Sequence 1: | NP_995843.3 | Gene: | CG33461 / 2768840 | FlyBaseID: | FBgn0053461 | Length: | 287 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 260 | Identity: | 56/260 - (21%) |
---|---|---|---|
Similarity: | 95/260 - (36%) | Gaps: | 84/260 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 GSLINQWFVLTSAHCI---EDDVELIARLGENNRDNDIDCENNRCLEA--TQEYNVDMLF----- 123
Fly 124 --------KHR-----------LY-----------DPKDFSNDIGMLRLERRVEYTYHIQPICIF 158
Fly 159 HHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQIC-AG 222
Fly 223 NDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKVVDWYGR 287
Fly 288 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33461 | NP_995843.3 | Tryp_SPc | 41..278 | CDD:214473 | 54/249 (22%) |
Tryp_SPc | 42..281 | CDD:238113 | 54/252 (21%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 54/249 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |