DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and try-9

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:260 Identity:56/260 - (21%)
Similarity:95/260 - (36%) Gaps:84/260 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GSLINQWFVLTSAHCI---EDDVELIARLGENNRDNDIDCENNRCLEA--TQEYNVDMLF----- 123
            |:|::.|.::|:||.|   ||.:.              ||:.....||  .::|...:.|     
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLP--------------DCDTGNLREAYFVRDYKNFVAFVNVTC 80

  Fly   124 --------KHR-----------LY-----------DPKDFSNDIGMLRLERRVEYTYHIQPICIF 158
                    .||           ||           |.:.| |||.:..||..:|::..|.|.|:.
 Worm    81 AVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESF-NDIAVFELEEPIEFSKDIFPACLP 144

  Fly   159 HHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQIC-AG 222
            ...::..:.:  |.:|..|:|...:|...:|.::   .:||.... :|:..|.   ..|..| :.
 Worm   145 SAPKIPRIRE--TGYKLFGYGRDPSDSVLESGKL---KSLYSFVA-ECSDDFP---YGGVYCTSA 200

  Fly   223 NDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKVVDWYGR 287
            .:.|..|.||||.         |:.|          ..:...|.:|..|:..|....::.|.:.|
 Worm   201 VNRGLSCDGDSGS---------GVVR----------TSDTRNVQVLVGVLSAGMPCPELYDTHNR 246

  Fly   288  287
             Worm   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 54/249 (22%)
Tryp_SPc 42..281 CDD:238113 54/252 (21%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 54/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.