DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG17572

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:283 Identity:85/283 - (30%)
Similarity:129/283 - (45%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEEN--CG--VVPRLSYKIINGTPARLGRYPWMA---FLHTPT---YFLCAGSLINQWFVLTSAH 82
            ||:|  ||  :|....||       .||.||::|   |.|..|   .:.|||::|.:..:||:||
  Fly   118 LEKNQVCGKSLVQGHFYK-------GLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAH 175

  Fly    83 CI---EDDVELIA-RLGENNRDNDIDCENNR-CLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRL 142
            |.   .|...|.: |:||.:..:|.||.|.. |...:..:.:..:..|..|....:.:||.:|.|
  Fly   176 CALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVL 240

  Fly   143 ERRVEYTYHIQPICIFHHRRMQLVVDQITWFKAT--GWGLTSTDLNTKSSR---------VLMEL 196
            :..:.|:...||||: ...|..|||.:    :||  |||    .::|.|.|         .|...
  Fly   241 KTPLNYSVATQPICL-QKTRANLVVGK----RATIAGWG----KMSTSSVRQPEMSHLDVPLTSW 296

  Fly   197 NLYRRPRNDCARIFKQNFLSGQ-ICAGNDDGNLCRGDSGGPQGRYVLIFGMKR--FVQMGIASFT 258
            :|..|.......:...|.:.|| :|||.:..::|:|..|.|      :|..:.  |.|:||.||.
  Fly   297 DLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAP------LFIQENGIFSQIGIMSFG 355

  Fly   259 YENCSKV---SILTDVVRYGRWI 278
            .:||..:   |:.|.|..:..||
  Fly   356 SDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 76/264 (29%)
Tryp_SPc 42..281 CDD:238113 77/265 (29%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 76/256 (30%)
Tryp_SPc 138..378 CDD:214473 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.