DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG4650

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:271 Identity:90/271 - (33%)
Similarity:138/271 - (50%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHT-PTYFLCAGSLINQWFVL 78
            ||:|.|.|||. :|:..||:       :.||..|.....||||:||| ...::|.|::|.:..||
  Fly    12 LFLLPVPGSSQ-YLDGRCGL-------LTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVL 68

  Fly    79 TSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLE 143
            |:|||.....:|:||:||....:|   .|:..|   .||.|...|.|.||:....:|||.:|.|.
  Fly    69 TAAHCTRASEQLVARIGEFIGTDD---ANDTML---SEYQVSQTFIHSLYNTTTSANDIAILGLA 127

  Fly   144 RRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCAR 208
            ..:.::..|:||||......:..:|.|.......|||.:....:.:.|:   .::.|:|.|.|:.
  Fly   128 TDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRI---TDIRRQPANMCST 189

  Fly   209 IFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVR 273
            :.....||.|.|||:.|..||..|...|.|..:....::|:|.:|||: |.:.|.:.|:.|||:.
  Fly   190 LNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRASVYTDVLS 253

  Fly   274 YGRWIKKVVDW 284
            :..:|..|  |
  Fly   254 HTDFILSV--W 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 77/237 (32%)
Tryp_SPc 42..281 CDD:238113 78/239 (33%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 77/234 (33%)
Tryp_SPc 33..258 CDD:304450 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.