DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG9377

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:269 Identity:64/269 - (23%)
Similarity:109/269 - (40%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDND 102
            |.||   ...|:.|.:||:..::....:||:|:||....|:|:|||:::......||.....|..
  Fly   100 LGYK---QQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAA 161

  Fly   103 IDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRL--ERRVEYTYHIQPICIFHHRRM-- 163
            ::.|.    :..|:.:|.....|..|.....:::|.:|.:  |:..:...::||||:...|.|  
  Fly   162 VELEP----QPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYN 222

  Fly   164 --QLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQ-------I 219
              |..|        :||  ..:|.. :::.:.....||..|.:.|....:.:.|..:       :
  Fly   223 YSQCYV--------SGW--QRSDFG-RAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLL 276

  Fly   220 CAGNDDGNLCRGD------------SGGPQGRYVLIFGMKRFVQMGIASFTYENC---SKVSILT 269
            |||.|.|:...||            ||...          ||...|:.:.| ..|   ..:.|.|
  Fly   277 CAGGDKGDFVCGDVDMTAVPLMCPLSGHDD----------RFHLAGLLTRT-ARCDGPQLLGIYT 330

  Fly   270 DVVRYGRWI 278
            :|..|.:||
  Fly   331 NVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 60/264 (23%)
Tryp_SPc 42..281 CDD:238113 61/265 (23%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 61/261 (23%)
Tryp_SPc 105..339 CDD:214473 59/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.