DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:320 Identity:70/320 - (21%)
Similarity:119/320 - (37%) Gaps:97/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVL----------------GVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYP 54
            ||..:..||:.:.                .|.||.|..:|.          :|.||.||..|:.|
  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEG----------RITNGYPAYEGKVP 55

  Fly    55 W---MAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQE 116
            :   :.|......:.|.||:|...:|:|:|||......:....|...|           |:|...
  Fly    56 YIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWR-----------LQAQYT 109

  Fly   117 YNVDM--LFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQIT-------- 171
            :.|..  ..:|..|:..:.:|||.::.       |.|:.    |.|     :::::.        
  Fly   110 HTVGSGHFRQHSDYNTNNLNNDISLIN-------TPHVD----FWH-----LINKVELPDGNERH 158

  Fly   172 ------WFKATGWGL------TSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQ-ICAGN 223
                  |..|:|||.      .|..||...|:::        .|::|:.::..:.::.. ||...
  Fly   159 DSFAGWWALASGWGRPCDSCGVSDYLNCVDSQII--------TRDECSSVYGTDVITDNVICTST 215

  Fly   224 DDG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSI---LTDVVRYGRWIK 279
            ..| :.|.||||||    :::....:.|  |:.||...:.....:   .|.|..|..||:
  Fly   216 PGGKSTCAGDSGGP----LVLHDRSKLV--GVTSFVAASGCTSGLPDGFTRVTSYLDWIR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 59/266 (22%)
Tryp_SPc 42..281 CDD:238113 61/268 (23%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 59/266 (22%)
Tryp_SPc 43..271 CDD:238113 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.