DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:105/276 - (38%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSSSVFLE----ENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFL 66
            ||..:|.|||.|    .|:|.|.|    ::.....::..:|.||..|..|:.|:...|.....:.
  Fly     1 MKVFLAILALAV----ASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWW 61

  Fly    67 CAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPK 131
            |.||:|...:|||:.|||.|...:|...|...|.|         .:.|.........||      
  Fly    62 CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTN---------AQFTHTVGNGNFIKH------ 111

  Fly   132 DFSN-DIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQIT--------------WFKATGWGLT 181
              || ||.::|:.       |:.    |.|     :|:::.              |..|.|||.|
  Fly   112 --SNADIALIRIP-------HVD----FWH-----MVNKVELPSYNDRYNNYNEWWAVACGWGGT 158

  Fly   182 STDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFG 245
            ............::|.:..  ..:|...: .:.....||....|| ::|.||||||   .|...|
  Fly   159 YDGSPLPDWLQCVDLQIVH--NEECGWTY-GSVGDNVICTRTVDGKSICGGDSGGP---LVTHDG 217

  Fly   246 MKRFVQMGIASFTYEN 261
            .|   .:|:::|...|
  Fly   218 SK---LVGVSNFVSSN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 59/237 (25%)
Tryp_SPc 42..281 CDD:238113 59/236 (25%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 59/237 (25%)
Tryp_SPc 37..253 CDD:238113 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.