DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and psh

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:275 Identity:81/275 - (29%)
Similarity:120/275 - (43%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLSYKIINGTPARLGRYPWMA---FLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELIA--RLGE 96
            :|...|:.|.|...|.||.||   ::...|.|.|.||||...||||:|||:..|....|  |||.
  Fly   139 QLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGA 203

  Fly    97 NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHR 161
            .|.:|..        .:.|:..:..:..|..|....: |||.:|.|||.|..|.:|:|.|:  |.
  Fly   204 VNIENPD--------HSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACL--HT 257

  Fly   162 RMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDC----------ARIFKQNFLS 216
            ..........:|.| |||:.:.....: |::|:...|...|.:.|          .|:.||..:.
  Fly   258 DATDPPSNSKFFVA-GWGVLNVTTRAR-SKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVID 320

  Fly   217 GQICAGNDD--GNLCRGDSGGP--------QGRYVLIFGMKRFVQMGIASFTYENCSKVS--ILT 269
            ..:||.:..  .:.|:||||||        .|.|.:         ||:.|..: .|:.|:  :.|
  Fly   321 SLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTI---------MGVISSGF-GCATVTPGLYT 375

  Fly   270 DVVRYGRWIKKVVDW 284
            .|..|..:|:.:| |
  Fly   376 RVSSYLDFIEGIV-W 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 77/263 (29%)
Tryp_SPc 42..281 CDD:238113 78/265 (29%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 77/263 (29%)
Tryp_SPc 144..387 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.