DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Hayan

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:276 Identity:73/276 - (26%)
Similarity:117/276 - (42%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSYKIINGTPARLGRYPWMAFLHTPTY----FLCAGSLINQWFVLTSAHCI--EDDVELIARLGE 96
            |:..|::|.....|.||.||.:...::    |.|.||||...||||:|||:  :|......|||.
  Fly   381 LTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGA 445

  Fly    97 NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHR 161
            .|.:|.        ....|:.||..:..|..|.......||.:|:|....:.:..|:|.|::..|
  Fly   446 LNIENP--------EPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDR 502

  Fly   162 RMQLVVDQITWFK--ATGWGLTSTDLNTKSSRVLMELNLYRRPRNDC----------ARIFKQNF 214
            .     |....:|  ..|||:.:. .|...|::|:...|...|.::|          .|..::..
  Fly   503 S-----DPPANYKYFVAGWGVMNV-TNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGV 561

  Fly   215 LSGQICAG--NDDGNLCRGDSGGP--------QGRYVLIFGMKRFVQMGIASFTYENCSKV-SIL 268
            ::.|:||.  |...:.|:||||||        .|.|.::         |:.|..:...:|. .:.
  Fly   562 IASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIV---------GVISSGFGCATKTPGLY 617

  Fly   269 TDVVRYGRWIKKVVDW 284
            |.|..:..:|:.:| |
  Fly   618 TRVSSFLDYIEGIV-W 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 69/265 (26%)
Tryp_SPc 42..281 CDD:238113 70/267 (26%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 69/265 (26%)
Tryp_SPc 385..630 CDD:238113 70/267 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.