DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG8952

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:120/265 - (45%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLSYKIINGTPARLGRYPWMAFLHTPTY--FLCAGSLINQWFVLTSAHCIEDDVELIARLGENNR 99
            ::..:|::|:.|:||::||...|....:  .||.||:|:..:|||:|||......:....|    
  Fly    33 KIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFG---- 93

  Fly   100 DNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQ 164
              .:|..|...|..|.    :.:..|..|:.| .:||:.:::|...:.::.:||.|        |
  Fly    94 --TVDLFNANALNMTS----NNIIIHPDYNDK-LNNDVSLIQLPEPLTFSANIQAI--------Q 143

  Fly   165 LV---VDQITWFKA----TGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIF-KQNFLSGQICA 221
            ||   .|.|.:..:    .|:|.|. |.....|..|:...:......||..|: |...:...:||
  Fly   144 LVGQYGDSIDYVGSVATIAGFGYTE-DEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCA 207

  Fly   222 GNDDG---NLCRGDSGGPQGRYVLIFG--MKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKV 281
            ...||   :.|.||||||    ::::.  ::::.|:||.||..|:.....:.:...|...::..:
  Fly   208 KGFDGSDMSTCTGDSGGP----LILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268

  Fly   282 VDWYG 286
            .|..|
  Fly   269 ADKTG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 66/251 (26%)
Tryp_SPc 42..281 CDD:238113 66/253 (26%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 66/254 (26%)
Tryp_SPc 38..271 CDD:238113 66/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.