DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and sphinx1

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:318 Identity:68/318 - (21%)
Similarity:109/318 - (34%) Gaps:112/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLC--- 67
            ||.::..|.|           .|..:.|...:||.:|..|..|:...   :.:|....||..   
  Fly     1 MKLVVTLLVL-----------SLTVSVGEKNKLSPRIAGGYRAKTFT---IIYLVGIVYFKSQTS 51

  Fly    68 -----AGSLI-NQWFVLTSAHCIE---DDVELIARLG-----------ENNR---DND-----ID 104
                 ||::| ||| :||....::   .:|.|.:|..           ||.|   |||     :.
  Fly    52 SLNYGAGTIISNQW-ILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVK 115

  Fly   105 CENNRCLEATQEYNVDMLFKHRL-------YDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRR 162
            |...:             |..|:       ||          .|.||   |..::..:|.:...:
  Fly   116 CPYQK-------------FDRRMDRVRVPAYD----------TRFER---YVGNMTMVCGYGTEK 154

  Fly   163 MQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQIC-AGNDDG 226
            ....:.:  |.:.....:.:   ||:.::....|..|                  ::| :|....
  Fly   155 RHAKLPE--WMRCIEVEVMN---NTECAKYYTPLKWY------------------EMCTSGEGFK 196

  Fly   227 NLCRGDSGGPQGRYVLIFGMK-RFVQMGIASFTYENCS--KVSILTDVVRYGRWIKKV 281
            .:|.||.||.    |:..|.. .|:  ||.....||||  ..|:...|..:.:|||:|
  Fly   197 GVCEGDIGGA----VVTMGPNPTFI--GIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 56/278 (20%)
Tryp_SPc 42..281 CDD:238113 59/280 (21%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/278 (20%)
Tryp_SPc 26..248 CDD:304450 59/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.