DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and spirit

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:117/260 - (45%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IINGTPARLGRYPWMAFL------HTPTYFLCAGSLINQWFVLTSAHCIE--DDVELIARLGENN 98
            ::.|.|.|...:|:||.|      ....|:.|.|:||...||||:|||.:  .:.....|||   
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLG--- 193

  Fly    99 RDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRM 163
                   .:|..|...::.::..:..|..|......|||.:|.||...:  ..::|.||:..:.:
  Fly   194 -------GDNLTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQKEV 249

  Fly   164 QLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFK-----QNFLSGQICAGN 223
                 ..|...|.|:|.||  ....||..|:::.|......:|...::     |..|..|:|||:
  Fly   250 -----TNTLVTAIGYGQTS--FAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGD 307

  Fly   224 DDG--NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSK--VSILTDVVRYGRWIKKVVDW 284
            ..|  :.|:||||||   .::..|:..:| :||.|.. :.|:.  .|:.|.|..:..||:.:| |
  Fly   308 ITGERDTCQGDSGGP---LLMQDGLLGYV-VGITSLG-QGCASGPPSVYTRVSSFVDWIEGIV-W 366

  Fly   285  284
              Fly   367  366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 69/252 (27%)
Tryp_SPc 42..281 CDD:238113 71/255 (28%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 71/255 (28%)
Tryp_SPc 132..361 CDD:214473 69/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.