DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG18420

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:286 Identity:109/286 - (38%)
Similarity:154/286 - (53%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALF-VLGVHGSSSVFLEENCGVVP--RLSYKIINGTPARLGRYPWMAFLHTPT-YFL 66
            |.:|:..|.:| :||    |:.||:..||...  :|..:|:||..|.....||||||||.: .|:
  Fly     8 MASILLLLTVFPLLG----STQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFI 68

  Fly    67 CAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPK 131
            |.|:||::..|||:|||...:..::.||||.||         :.....:|:.|:..|:||.|||.
  Fly    69 CGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNR---------KLKGYREEHQVNRTFQHRFYDPN 124

  Fly   132 DFSNDIGMLRLERRVEYTYHIQPICIF------HHRRMQLVVDQITWFKATGWGLTSTDLNTKSS 190
            ..:|||.:|||...|.|..:|:||||.      ||      :|.|.....||||.|.   :...|
  Fly   125 THANDIALLRLVSNVVYKANIRPICIMWDASWKHH------IDSIKVLTGTGWGRTE---SMHDS 180

  Fly   191 RVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIA 255
            ..|..|::.|:|...||   ..:.||.|.||||.:.|||.||:|||.|..|......||||:|||
  Fly   181 SELRTLDISRQPSKMCA---FGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIA 242

  Fly   256 SFTYENCSKVSILTDVVRYGRWIKKV 281
             .|.:.|.:.|:.|||:.:..:|:::
  Fly   243 -ITNKRCQRPSVFTDVMSHIEFIRRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 96/243 (40%)
Tryp_SPc 42..281 CDD:238113 97/245 (40%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 96/243 (40%)
Tryp_SPc 43..267 CDD:238113 97/245 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463340
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.