DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33225

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:283 Identity:85/283 - (30%)
Similarity:132/283 - (46%) Gaps:20/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAYLALFVLGVHGSSSVFLEENCGVV--PRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLI 72
            |..||..|||....||..|..:||..  |....:::.|..|.....|||..:.......|:||||
  Fly    23 IVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLI 87

  Fly    73 NQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSN-D 136
            .:.||||||.|:....:.:. |||.:|    :|.:..|....|..::|....|..:..:.... |
  Fly    88 TRLFVLTSASCLLSLPKQVI-LGEYDR----NCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYD 147

  Fly   137 IGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRR 201
            |.:|||.::|..:.:::|||:...|:   |...:..|.|||||.|..:   :.|.:|..:.|.:.
  Fly   148 IALLRLAKKVSISDYVRPICLSVDRQ---VGRSVQHFTATGWGTTEWN---EPSTILQTVTLSKI 206

  Fly   202 PRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFG------MKRFVQMGIASFTYE 260
            .|..|....:||..:.|:|.|....:.|.||:|||....:.|.|      ..|...:||.|:...
  Fly   207 NRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSS 271

  Fly   261 NCSKVSILTDVVRYGRWIKKVVD 283
            :||.:.:.|:|..|..||.:.::
  Fly   272 SCSGIGVYTNVEHYMDWIVRTIN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 71/243 (29%)
Tryp_SPc 42..281 CDD:238113 73/245 (30%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 71/243 (29%)
Tryp_SPc 57..292 CDD:238113 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.