DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33226

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:282 Identity:92/282 - (32%)
Similarity:140/282 - (49%) Gaps:21/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALFVLGVHGSSSV---FLEENCGVVP-RLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73
            |..|:|.:....|:   .|:.||...| .:..:|:.|..|.:..:|||..:....|..|.||||:
  Fly    14 LVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLIS 78

  Fly    74 QWFVLTSAHCIEDDVELIARLGENNRDNDID----CENNRCLEATQEYNVDMLFKHRLYDPKDFS 134
            ..||||:||| .....|..|.|   |.:.|.    |.:..|.....|.:|..:|.|..|  :|:.
  Fly    79 SLFVLTAAHC-HSRYRLKVRFG---RYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY--RDYH 137

  Fly   135 N-DIGMLRLERRVEYTYHIQPICIF---HHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLME 195
            | ||.:..|.:.|.|....:|||:.   :..:::..::.:..|..||||.|.:.|   :|.:|..
  Fly   138 NYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQL---TSTILQT 199

  Fly   196 LNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYE 260
            .:|:...|..||:||.:......||||:...:.|.||||||....:...|:||.|..||.|:...
  Fly   200 TSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAP 264

  Fly   261 NCSKVSILTDVVRYGRWIKKVV 282
            ||.:|::.|:|:||..||:.:|
  Fly   265 NCREVTVFTNVLRYSNWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 81/244 (33%)
Tryp_SPc 42..281 CDD:238113 83/246 (34%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 83/246 (34%)
Tryp_SPc 47..282 CDD:214473 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.