DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33459

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:283 Identity:104/283 - (36%)
Similarity:142/283 - (50%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEMKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCA 68
            |.:.:|||...|:.|      :|.||.|||.:| ...:|..|..|.|...|||||||....|||.
  Fly     7 LLVSSIIANQLLYGL------AVLLEPNCGQIP-FRMRIFGGMDAGLVSTPWMAFLHNHLQFLCG 64

  Fly    69 GSLINQWFVLTSAHCI-EDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKD 132
            ||||...||||:|||: .....|..||||.:....:|..|.:  ...:||.|..::.|..| ...
  Fly    65 GSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPK--HRHREYMVTRIYTHPSY-RSI 126

  Fly   133 FSNDIGMLRLERRVEYTYHIQPICI-----FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRV 192
            .:.||.:|:|.:.||||..|:|||:     ||  ....:||.:..|..||||.|.|:   ..|:|
  Fly   127 AAYDIALLKLNQTVEYTVAIRPICLVLPENFH--EWYWLVDSVEDFTLTGWGATKTE---PVSQV 186

  Fly   193 LMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFV--QMGIA 255
            |...||.:..|..|...:..:.....||||:.....|.||||.|....|:  ..:|::  |:||.
  Fly   187 LQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVV--HNRRYIHAQVGIV 249

  Fly   256 SFTYENCSKVSILTDVVRYGRWI 278
            |...:||..|::.|:||.:..||
  Fly   250 SRGPKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 89/244 (36%)
Tryp_SPc 42..281 CDD:238113 91/245 (37%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 89/244 (36%)
Tryp_SPc 38..272 CDD:238113 89/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.