DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33458

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:284 Identity:110/284 - (38%)
Similarity:151/284 - (53%) Gaps:16/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSS---SVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLC 67
            ||.|.|.|||.:|| ||.|   |..||.:|| :.:.:|:|..|..:.|...||:|:||..:.|:|
  Fly     1 MKLIPALLALLILG-HGISLGYSYLLEWDCG-ISKYTYRITGGRDSPLMLNPWLAYLHINSKFIC 63

  Fly    68 AGSLINQWFVLTSAHCIED-DVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPK 131
            .|||:|.|||||:|||..| :.:::.|||||:....|||..:.|.....||.:.....|.||...
  Fly    64 GGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTA 128

  Fly   132 DFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMEL 196
            .: .||.:.:|.|.|.||..|:|||:..:...|:.||.|.:|..||||.|:      :|.|..:|
  Fly   129 HY-YDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATN------ASEVSDKL 186

  Fly   197 NLYRRPRND---CARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFT 258
            .|.|.|:.|   |...|........||||.....:.:||||||.|..|.....|||.|.||.|..
  Fly   187 QLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHL 251

  Fly   259 YENCSKVSILTDVVRYGRWIKKVV 282
            .:....||:.|:::.|..||.:.:
  Fly   252 RQPFHGVSVFTNILSYSNWIHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 90/240 (38%)
Tryp_SPc 42..281 CDD:238113 92/242 (38%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 90/240 (38%)
Tryp_SPc 38..274 CDD:238113 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.