DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG33462

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:281 Identity:130/281 - (46%)
Similarity:172/281 - (61%) Gaps:17/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FVLG----------VHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGS 70
            |::|          |.| ..:.|||:||:...:|.:.:|   |:|.:.||||:|.||..|.|:|:
  Fly     4 FIIGIAVICCLWRRVQG-FQMLLEEDCGIPHNISERSVN---AKLAQNPWMAYLETPKGFHCSGT 64

  Fly    71 LINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSN 135
            |||..||||:|||:.||:.:..||||.|....:||:|:.|.|..|||||||.|:||.|:..|.:|
  Fly    65 LINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTN 129

  Fly   136 DIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYR 200
            |||||||.|||||..||:|||||...|.|..:||:|||..|.|..|:.:   .:|:||..:|:.|
  Fly   130 DIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAAN---ATSKVLRTMNIDR 191

  Fly   201 RPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKV 265
            :|:..|:.|:..|....||||||....||..|||.||.|.:...|..|:||:||||.....|...
  Fly   192 QPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS 256

  Fly   266 SILTDVVRYGRWIKKVVDWYG 286
            .||.|::.|..|||:||..||
  Fly   257 GILMDLLSYADWIKRVVRQYG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 113/236 (48%)
Tryp_SPc 42..281 CDD:238113 116/238 (49%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 113/226 (50%)
Tryp_SPc 48..269 CDD:214473 110/223 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463318
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.