DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Sp212

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:279 Identity:77/279 - (27%)
Similarity:126/279 - (45%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLH----TPTYFLCAGSLINQWFV 77
            |.|..||::.|              |:.|.....|:|||::.::    ....|.|.||||:...|
  Fly   266 VCGREGSTTPF--------------IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIV 316

  Fly    78 LTSAHCI----EDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSN-DI 137
            :::|||:    ||.|  :..||..:.|:..:       :..:..||..|..|..|:.:.:|: ||
  Fly   317 ISAAHCVHRMTEDRV--VVGLGRYDLDDYGE-------DGAEMRNVMRLLWHPDYNTRSYSDADI 372

  Fly   138 GMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRP 202
            .::.:||.|.:...|.|||::.....:.|  ..|.|.| |||.......|:..|| :|..:  ..
  Fly   373 ALITIERPVTFNDIIAPICMWTVEASRTV--STTGFIA-GWGRDEDSSRTQYPRV-VEAEI--AS 431

  Fly   203 RNDCARIFKQNFLSGQ-ICAGNDDGN-LCRGDSGG----PQGRYVLIFGMKRFVQMGIASFTYEN 261
            ...||..::...::.: :||||.||: .|.|||||    .||...|:.|:....:.|.|.....|
  Fly   432 PTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLN 496

  Fly   262 CSKVSILTDVVRYGRWIKK 280
              :..:..|:.::..||.:
  Fly   497 --QYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 70/251 (28%)
Tryp_SPc 42..281 CDD:238113 72/254 (28%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 72/254 (28%)
Tryp_SPc 277..511 CDD:214473 70/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.