DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30323

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:256 Identity:56/256 - (21%)
Similarity:97/256 - (37%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPK 131
            |||||::.|:|:||..|:....|.......|.::..:.....:.|:.....|:..:.|..| |..
  Fly    54 CAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVL-DES 117

  Fly   132 DFS--NDIGMLRLER-------------------------------RVEYTYHIQPICIFHHRRM 163
            ..|  .::.:|:|:|                               .|.|.| |..:|    ...
  Fly   118 AISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVY-ISAMC----PAF 177

  Fly   164 QLVVDQ-ITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGN 227
            .:|.|. :|||:.   |..|::|....::.:.|...    :.||:|.......:|:       ||
  Fly   178 SMVYDNPVTWFQD---GPYSSELIQIRAQKISEYEC----KPDCSRCLCMTSYTGR-------GN 228

  Fly   228 LCRGDSGGPQGRYVLIFGMKRFVQM----GIASFT--YENCSKVSILTDVVRYGRWIKKVV 282
            :|:.|.|.|......::|:.|.|..    |...:|  |:|   ...:.|.:....|.|:|:
  Fly   229 MCQQDLGSPLFCDHFLYGVARRVHTCDDEGFMFYTNIYQN---RKFIEDTLSGATWPKRVL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 53/250 (21%)
Tryp_SPc 42..281 CDD:238113 55/253 (22%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 52/243 (21%)
Tryp_SPc 45..272 CDD:214473 52/240 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.