DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30289

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:297 Identity:97/297 - (32%)
Similarity:138/297 - (46%) Gaps:40/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGV------VPRLSYKIINGTPARLGRYPWMAFLHT--P 62
            :..:||.|....:..:...|..|.||||:      ||    .|..|....:...|||..:.:  |
  Fly     4 INAVIAALVCLFIANNNVMSRLLVENCGISKDDPYVP----NIFGGAKTNIQENPWMVLVWSSKP 64

  Fly    63 TYFLCAGSLINQWFVLTSAHCIEDDVELIARLGE-NNRDNDIDCENNRCLEATQEYNVDMLFKHR 126
                |.||||.:.||||:|||:..: :|..|||: ...|....|.||.|:......:|||...|.
  Fly    65 ----CGGSLIARQFVLTAAHCVSFE-DLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHE 124

  Fly   127 LYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSR 191
            .|:.....|||.:||:...|||:.:::|||:....:||    .|..|..||||.|...   :.||
  Fly   125 NYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQ----SIPMFTVTGWGETEYG---QFSR 182

  Fly   192 VLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGP------QGRYVLIFGMKRFV 250
            :|:...||....:.|...|.:.....|||||:...|.|:||||||      .|..:|.|      
  Fly   183 ILLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSF------ 241

  Fly   251 QMGIASFTYENCSK--VSILTDVVRYGRWI-KKVVDW 284
            |.|:.|:..|.|:.  ..:.|:|..:..|| .|:|.:
  Fly   242 QYGLVSYGSERCAANVAGVYTNVSYHREWIFNKMVQF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 82/247 (33%)
Tryp_SPc 42..281 CDD:238113 84/250 (34%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 82/246 (33%)
Tryp_SPc 42..271 CDD:238113 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.760

Return to query results.
Submit another query.