DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30288

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:282 Identity:89/282 - (31%)
Similarity:135/282 - (47%) Gaps:13/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEMKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSY--KIINGTPARLGRYPWMAFLHTPTYFL 66
            |.::.::....||:..:...|...||.:||......|  :|..|..|.:...|||..:......:
  Fly     3 LPIRQLVIVACLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAV 67

  Fly    67 CAGSLINQWFVLTSAHCIEDDVELIARLGE-NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDP 130
            |.||||...||||:.||| ..:.:..|||| :.|....||::..|  ..:.||||:..|....:|
  Fly    68 CGGSLITARFVLTAEHCI-SPMYMNVRLGEYDTRHPIFDCDDFVC--TPRAYNVDVDRKIVHSNP 129

  Fly   131 KDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLME 195
               ..|||:||::|.|.::.:::|||:...:.:......|..|..||||   |:.:.:....|..
  Fly   130 ---GYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWG---TNSDGEEQDRLQT 188

  Fly   196 LNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYE 260
            ..|.:.|:..|.|..:...:| .||||:...:.|:||||||........|..|..|.|:||....
  Fly   189 ATLQQLPQWSCERPGRPLDIS-YICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLR 252

  Fly   261 NCSKVSILTDVVRYGRWIKKVV 282
            .||.:.|.|:|..:..||..|:
  Fly   253 LCSGLGIYTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 77/237 (32%)
Tryp_SPc 42..281 CDD:238113 79/239 (33%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 77/237 (32%)
Tryp_SPc 45..270 CDD:238113 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.