DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30286

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:88/258 - (34%)
Similarity:146/258 - (56%) Gaps:8/258 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSSVFLEENCGVVPRLSYKIINGT--PARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIE 85
            :::.|||.:||.   :|.:.:...  .|.:...||||:||.....:|.|:|:|..|:||:||||.
  Fly    17 ATAQFLEPDCGY---MSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIR 78

  Fly    86 DDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTY 150
            :|..|..||||.|....|||..:.||..::::.:|:.|:|..|...:..:|||:|||.:.|||..
  Fly    79 EDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKV 143

  Fly   151 HIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFL 215
            ||:|||:..:..:|..::::....|||||.:.::   .::.:|..:.:.|.....|::.:..:..
  Fly   144 HIKPICLITNTTLQPKIERLHRLVATGWGRSPSE---AANHILKSIRVTRVNWGVCSKTYWVDRR 205

  Fly   216 SGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWI 278
            ..|||..::.|..|.||||||.|:.:.:.|...|||:||.|:....|...|:.|:|:.:..||
  Fly   206 RDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 80/238 (34%)
Tryp_SPc 42..281 CDD:238113 82/239 (34%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 82/233 (35%)
Tryp_SPc 39..268 CDD:214473 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463338
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.