DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30098

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:280 Identity:97/280 - (34%)
Similarity:144/280 - (51%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73
            ::.:|.:..||.:|.|.: |:..|..:.|:  ::|.|..||  |.||||:|.....|.|.||||.
  Fly     7 LLTFLVILTLGSYGYSQL-LDSKCIALFRI--RVIGGQNAR--RTPWMAYLIRDNRFACGGSLIA 66

  Fly    74 QWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSN-DI 137
            ..||||:|||.:.:..|..||||.:.....|.:       |:.|.|..:::|:.|  .||.| ||
  Fly    67 YRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ-------TRSYRVVSIYRHKNY--IDFRNHDI 122

  Fly   138 GMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRP 202
            .:|:|:|:|.|..:|:||||..:..:|.:.:.|..|..||||..:.  ..|....|.|::| ||.
  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAH--YYKMPTTLQEMSL-RRV 184

  Fly   203 RNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKR-FVQMGIASFTYENCSKVS 266
            ||:...:     .|..||..|.....|.||||||.|..|. :|.|. :||.|:.:....||...|
  Fly   185 RNEYCGV-----PSLSICCWNPVQYACFGDSGGPLGSLVK-YGHKTIYVQFGVTNSVTGNCDGYS 243

  Fly   267 ILTDVVRYGRWIKKVV--DW 284
            ...|::.|..|:.:.:  :|
  Fly   244 SYLDLMSYMPWLYQTLLRNW 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 87/238 (37%)
Tryp_SPc 42..281 CDD:238113 88/240 (37%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 87/237 (37%)
Tryp_SPc 37..258 CDD:238113 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463375
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.740

Return to query results.
Submit another query.