DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30087

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:287 Identity:90/287 - (31%)
Similarity:144/287 - (50%) Gaps:23/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSSSV---FLEENCGVV--PRLSYKIINGTPARLGRYPWMAFLHTPTYF 65
            |||..|:..:.:..:.....|   ||...|||.  .:.:.:::||..|.:...|:|.::...:..
  Fly     1 MKTSPAWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLT 65

  Fly    66 LCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDP 130
            .|.||::|..::||:|||:..::.|  ||||:|...|.||:.:.|...::||.:.....||.|:.
  Fly    66 HCGGSILNSRYILTAAHCVFPNLRL--RLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA 128

  Fly   131 KDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTD-----LNTKSS 190
            .:..|||.:|:|.|.:.:..|||||||..:   ......:..::..|||.|..:     |.|   
  Fly   129 ANHVNDIALLKLNRSINFNVHIQPICILLN---PASAPSVATYQTFGWGETKKNGFPHLLQT--- 187

  Fly   191 RVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIA 255
               .||..|....  |:|.|.......|||||:::.:.|.||||||....|...|:||::|:||.
  Fly   188 ---AELRAYDAAY--CSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIV 247

  Fly   256 SFTYENCSKVSILTDVVRYGRWIKKVV 282
            |:...:|....:.|.|..|..||::.:
  Fly   248 SYGPTDCQSPGVYTYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 78/241 (32%)
Tryp_SPc 42..281 CDD:238113 80/243 (33%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 78/241 (32%)
Tryp_SPc 42..272 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463339
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.890

Return to query results.
Submit another query.