DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG30082

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:284 Identity:101/284 - (35%)
Similarity:149/284 - (52%) Gaps:12/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTI-IAYLALFVLGVHGSSSVFLEENCGVVPRL--SYKIINGTPARLGRYPWMAFLHTPTYFLC 67
            ||:: ||..|..|.......:.|::.|||....|  :.:|:.|..|.:|..||:|:||..:..:|
  Fly     1 MKSLWIASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVC 65

  Fly    68 AGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPK- 131
            .|:||.:.||||:|||:.....|..||||.:....|||.:..|:...:||:|:..:.|..:..: 
  Fly    66 TGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQ 130

  Fly   132 DFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDL-NTKSSRVLME 195
            |..||||:|:|...|.|...|:|||:|   |....|...:.::|.|||  ..|| ||  :.||..
  Fly   131 DSRNDIGLLKLNGTVVYKLFIRPICLF---RDPGQVPYSSTYEAAGWG--KIDLINT--ATVLQT 188

  Fly   196 LNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYE 260
            :||.|..::||.|..:.:...||.|||....:.|.||||||..|.:....:.|.||:||.|:.:.
  Fly   189 VNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHY 253

  Fly   261 NCSKVSILTDVVRYGRWIKKVVDW 284
            .|....:.|.|..:..||..:..|
  Fly   254 LCRGPGVYTYVPSFTNWILSITRW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 87/238 (37%)
Tryp_SPc 42..281 CDD:238113 89/240 (37%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 87/238 (37%)
Tryp_SPc 40..274 CDD:238113 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463333
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.