DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG43742

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:279 Identity:99/279 - (35%)
Similarity:138/279 - (49%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELIA 92
            |:|||.|  :::|::.||..|...::  ||.|:..:.|.|.||||::.:|||:|||:.|..|:..
  Fly    23 LDENCKV--KITYRVANGHTAITSQF--MAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDEVTV 83

  Fly    93 RLGENNRDNDID-CENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPIC 156
            .||||||...|. |::...|.|       .:..|..:....|.|||.:|||||.|.:..||:|||
  Fly    84 HLGENNRSCPIPVCKHVLRLNA-------KVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPIC 141

  Fly   157 IFHHRRMQLVVDQITW-----FKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLS 216
            |       ::.:.:|.     |.|.|||.|.   :...|.||..::|.|.|::.|    .||.  
  Fly   142 I-------ILDEDVTSNNQNNFTAYGWGKTE---HGNISDVLSFIDLVRLPKSMC----YQNI-- 190

  Fly   217 GQICAGNDDGNLCRGDSGGPQ-GRYVLIFGMKRFVQMGIASFTYENCSKV-SILTDVVRYGRWIK 279
            ..||||:..|:.|..|||||. |.:| ..|..|.:..||.|:....||.: .:.|||..|..||.
  Fly   191 NTICAGSTSGDTCESDSGGPLIGNFV-HRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIA 254

  Fly   280 KVV--------------DW 284
            .||              ||
  Fly   255 SVVLESEPRLLNEYCKSDW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 87/244 (36%)
Tryp_SPc 42..281 CDD:238113 89/246 (36%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 87/244 (36%)
Tryp_SPc 35..256 CDD:238113 89/246 (36%)
Tryp_SPc 273..467 CDD:214473 1/1 (100%)
Tryp_SPc 273..>368 CDD:304450 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463373
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.