DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Egfbp2

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:292 Identity:71/292 - (24%)
Similarity:125/292 - (42%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73
            :|.:|||.:.|:..:            |.|..:::.|...:....||...::.....:|.|.|::
Mouse     4 LILFLALSLGGIDAA------------PPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLD 56

  Fly    74 QWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEAT---QEYNVDMLFKHRLYDPKDFSN 135
            :.:|||:|||..|..|:  .||:|....:.....:|.:..:   ..:|:.:|....:....||||
Mouse    57 RNWVLTAAHCYVDQYEV--WLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSN 119

  Fly   136 DIGMLRLERRVEYTYHIQPI------------CIFHHRRMQLVVDQITWFKATGWG-LTSTDLNT 187
            |:.:|||.:..:.|..::||            |:                 |:||| :|.|....
Mouse   120 DLMLLRLSKPADITDVVKPIALPTKEPKPGSKCL-----------------ASGWGSITPTRWQK 167

  Fly   188 KSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG--NLCRGDSGGPQGRYVLIFGMKRFV 250
            ......:.:.|.  |..:||:::.|......:|||...|  :.||.|||||    ::..|    :
Mouse   168 PDDLQCVFITLL--PNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGP----LICDG----I 222

  Fly   251 QMGIASFTYENCSK---VSILTDVVRYGRWIK 279
            ..|..|:....|.|   .:|.|:::::..|||
Mouse   223 LQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 61/257 (24%)
Tryp_SPc 42..281 CDD:238113 64/259 (25%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 61/257 (24%)
Tryp_SPc 25..256 CDD:238113 64/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.