DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG43124

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:283 Identity:67/283 - (23%)
Similarity:119/283 - (42%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGS 70
            |.|....:...||..:..|:..|||:|  |..:  :.|||:    ...||:|.:.:.:..:|||:
  Fly     1 MNTARWIVLCIVLMFYQGSAQTLEEDC--VDHM--ERINGS----SYAPWLAEILSDSKVICAGA 57

  Fly    71 LINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSN 135
            |||..:|||:|.|.:::.:|..|||....|           ::.:.:.|...:....:.|.:.:|
  Fly    58 LINNLYVLTAASCFKENEKLTVRLGSGYFD-----------KSYENFRVTKAYFWMTHFPANNTN 111

  Fly   136 DIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYR 200
            ::.:.||:..||:..||:|:||....            |:.|...|...:|.|            
  Fly   112 NLCIFRLQTEVEFKTHIRPMCITKSP------------KSLGLATTFEIINEK------------ 152

  Fly   201 RPRNDCARIFKQNFLSGQICA---GNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASF----T 258
             |:   ...|.:| :.|..|.   |.::.......:|.|....:.....|..|:.||.|:    |
  Fly   153 -PK---MWYFCKN-IKGLFCKYVFGENEEKWQSKPTGSPWTETISNGPFKGLVRYGILSYRDNKT 212

  Fly   259 YENCSKVSILTDVVRYGRWIKKV 281
            |:     .:..:|:.:..||.::
  Fly   213 YD-----EVYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 55/243 (23%)
Tryp_SPc 42..281 CDD:238113 57/245 (23%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.