DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG43125

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:303 Identity:82/303 - (27%)
Similarity:120/303 - (39%) Gaps:107/303 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALFVLGV-HGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL--HTPTYFLCAGSLINQ 74
            ||:|.|.: :..|::|||:|||       |....:||     ||:..:  ...:...|.|:|||:
  Fly     7 LAVFALLLFYQGSALFLEQNCG-------KSSVFSPA-----PWLVKIRPELSSNITCTGTLINE 59

  Fly    75 WFVLTSAHCIEDDVELIARLGENNRDNDID--CENNRCLEATQEYNVDMLFKHRLYDPKDFSNDI 137
            .||||:|.||:...|||.||||      ||  .:|:..|:..:.|....|. ||.|..:....:|
  Fly    60 RFVLTAASCIDYQTELIVRLGE------IDGTLQNSSKLQYEEIYVARALI-HRSYSSESHQYNI 117

  Fly   138 GMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNT----KSSRVLMELNL 198
            .:|||:..|.|..:||||||                          |:|.    |:....:|...
  Fly   118 ALLRLKTSVVYKKNIQPICI--------------------------DVNVGKVPKAPTFEIEKKK 156

  Fly   199 YRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKR--------------- 248
            ...|:.:.|.|.|: ||:.                      ::.:||::.               
  Fly   157 NEEPKKNKAGIMKR-FLNW----------------------FLSLFGVREPRPDVILPPQPIAVG 198

  Fly   249 ------------FVQMGIASFTYENC-SKVSILTDVVRYGRWI 278
                        |.|.||.|  :.|. ||..:.|||:.|..||
  Fly   199 WPLTKQINESALFHQYGILS--HRNSESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 69/272 (25%)
Tryp_SPc 42..281 CDD:238113 70/273 (26%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.