DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG42694

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:303 Identity:89/303 - (29%)
Similarity:138/303 - (45%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKTIIAY-LALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYP---WMAFLHTPTYFL 66
            |:|:.|: |.|.||..|.:|. ||::.||.      .|.|.:..:| |.|   |:|.:...|:.|
  Fly     1 MQTLFAWLLMLTVLQSHVNSK-FLDDYCGA------PISNQSITKL-RQPQAGWLAHISNGTHVL 57

  Fly    67 CAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQE---YNVD--MLFKHR 126
            |:||||::.|||::|.||:...:|..:||.:|              ||:.   |.|.  ::..| 
  Fly    58 CSGSLISKQFVLSAAQCIDVHGKLFVQLGVSN--------------ATKSPHWYTVSNVVIPSH- 107

  Fly   127 LYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSR 191
              ..|....|||:|:|.:.|:|...:.||||..:.....:|..:..|..:.|  .|.:.|.::. 
  Fly   108 --SGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAW--LSKNKNPQTI- 167

  Fly   192 VLMELNLYRRPRNDCARIFKQNFLSGQICAGN-DDGNLCRGDSGGP------QGRYV---LIFGM 246
            ||.:|:     |:.|......|....:|||.: ...|.|..|||..      ||..:   ::||:
  Fly   168 VLSQLS-----RDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGI 227

  Fly   247 KRFVQMGIASFTYEN----CSKVSILTDVVRYGRWIKKVVDWY 285
            :.:|          |    ||:.:|..||.....||:.||..|
  Fly   228 RGYV----------NGRSWCSEPAIYIDVAECVGWIETVVQQY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 71/258 (28%)
Tryp_SPc 42..281 CDD:238113 73/260 (28%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 68/244 (28%)
Tryp_SPc 46..253 CDD:214473 66/241 (27%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.