DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and SPINK7

DIOPT Version :10

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_115955.1 Gene:SPINK7 / 84651 HGNCID:24643 Length:85 Species:Homo sapiens


Alignment Length:36 Identity:13/36 - (36%)
Similarity:21/36 - (58%) Gaps:1/36 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC 604
            ||||:|..||..||.|...:.: :|.:::..:.|.|
Human    51 PVCGSDYITYGNECHLCTESLK-SNGRVQFLHDGSC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 12/34 (35%)
KAZAL_FS 654..687 CDD:238052
KAZAL_FS 723..767 CDD:238052
SPINK7NP_115955.1 KAZAL_PSTI 41..85 CDD:238648 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.