DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and SPINK7

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_115955.1 Gene:SPINK7 / 84651 HGNCID:24643 Length:85 Species:Homo sapiens


Alignment Length:36 Identity:13/36 - (36%)
Similarity:21/36 - (58%) Gaps:1/36 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC 604
            ||||:|..||..||.|...:.: :|.:::..:.|.|
Human    51 PVCGSDYITYGNECHLCTESLK-SNGRVQFLHDGSC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 12/34 (35%)
KAZAL_FS 654..687 CDD:238052
KAZAL_FS 723..767 CDD:238052
SPINK7NP_115955.1 KAZAL_PSTI 41..85 CDD:238648 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.