DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and RECK

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_066934.1 Gene:RECK / 8434 HGNCID:11345 Length:971 Species:Homo sapiens


Alignment Length:664 Identity:127/664 - (19%)
Similarity:193/664 - (29%) Gaps:263/664 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 THLGSGK--CGQVFSTDISRSECC-------GSSQSFSYTDR--ELSSVEYFFATAIGGGVECSP 270
            |.|...|  |....:|...|..|.       |::||:...||  |.:.||....|.:....|  |
Human   283 TGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVRE--P 345

  Fly   271 CMESCKGFKCGPNKKCVKRKGRPKCVCAPECGAALRRRTHQQELELEQEPELEEEQQEMKPPR-- 333
            |...|:..     ..|.....||                    .||.:....:.:|..|...:  
Human   346 CQLGCRNL-----TYCTNFNNRP--------------------TELFRSCNAQSDQGAMNDMKLW 385

  Fly   334 ESRSLSSENTNFNLGLDGGQRQRADNQRKLQPRESKHRRLLIIDSSSRSSSNLPDQPTSGRRGRV 398
            |..|:.....|..: ||         .:|.||...|           ..:.:|..:|.       
Human   386 EKGSIKMPFINIPV-LD---------IKKCQPEMWK-----------AIACSLQIKPC------- 422

  Fly   399 EMTGYERRRHRNNHGKHLTRS------MTTGANDSFPADKTPAQ-----SPA--------ADSIL 444
                     |..:.|..:.:|      ...|..:.||.|.|...     ||.        .|:.|
Human   423 ---------HSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYL 478

  Fly   445 AQSRLANL-------ANANE-PAN---DINRQ----------------------SSTRVRHQHAR 476
            ..|.|.|:       .|.|. |||   ::||:                      |...||.....
Human   479 RPSTLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQGTLI 543

  Fly   477 RIEHAPNP----------DNGLRK---RQH-----------KQQQQHQHQHQDRMNTEAQSANTT 517
            ::..:...          .:||.:   ..|           .:::.|........|..:..|...
Human   544 QVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNVCSCFAGNL 608

  Fly   518 VSGSGSGATNHRRISQLQHGSETAASSDLANTHDLAHLGGIYAPLPPQHSN---PVCGTDGRTYN 579
            |..:        |:...:|.||     |...|         :..||...::   ||||.:||||.
Human   609 VCST--------RLCLSEHSSE-----DDRRT---------FTGLPCNCADQFVPVCGQNGRTYP 651

  Fly   580 TECQLRKRACRTNNAQLEVAYRGHC--KNSCSGVHCLNGLTCVE--------------DQYLMPH 628
            :.|  ..|.....:.|.|.   |.|  |:.|:...|.....|:.              .||   .
Human   652 SAC--IARCVGLQDHQFEF---GSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQY---E 708

  Fly   629 CIACRIECPWDNLDVDSSGYDERQ-AVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPCRAGRV 692
            |:..::.|            |:.| .||..|...:.:.|.:.:      |..:::|.|||     
Human   709 CVPRQLAC------------DQVQDPVCDTDHMEHNNLCTLYQ------RGKSLSYKGPC----- 750

  Fly   693 SCADIKCGPKDNCLVDLQTRQPRCVTCRYKCPRKQQRPVHKICGYNNQTYNSWCEMHKHSCESRY 757
                                ||.|            |....:||:|.:||:|.|..:.......|
Human   751 --------------------QPFC------------RATEPVCGHNGETYSSVCAAYSDRVAVDY 783

  Fly   758 F-----IGVKSQGS 766
            :     :||.|:.|
Human   784 YGDCQAVGVLSEHS 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 13/42 (31%)
KAZAL_FS 654..687 CDD:238052 7/32 (22%)
KAZAL_FS 723..767 CDD:238052 13/49 (27%)
RECKNP_066934.1 OATP <633..>658 CDD:281175 9/26 (35%)
Amnionless <802..>886 CDD:291494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.