DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and tmeff2b

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:XP_005165802.1 Gene:tmeff2b / 797681 ZFINID:ZDB-GENE-101001-4 Length:358 Species:Danio rerio


Alignment Length:230 Identity:60/230 - (26%)
Similarity:84/230 - (36%) Gaps:72/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 GIYAPLPPQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC----KNSCSGVH----- 612
            |.||        ||||::|.:|...|.|||.||:.....|.|: .|.|    :::.||..     
Zfish    98 GDYA--------PVCGSNGESYENHCLLRKDACKLQTEVLVVS-DGACPVGTRDAGSGSGDDANE 153

  Fly   613 ---------------CLNGLTCVEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTY 662
                           |..|..|.||...: .|: |.|:|          .:.....||..||::|
Zfish   154 GSAEISQKETSTCDICQFGAECDEDSEDV-WCV-CNIDC----------SHISFNPVCASDGRSY 206

  Fly   663 RSACDINRMICKIGRSIAVAYPGPCRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRYK--CPR 725
            .:.|.:..:.|:....|.|.|.|.|:..:...:::..|....|        |.    |||  |  
Zfish   207 DNPCQVKEVSCQKQERIEVKYLGHCKEEKDQVSEVPWGLYIPC--------PE----RYKDYC-- 257

  Fly   726 KQQRPVHKICGYNNQTYNSWCEMHKHSCESRYFIG 760
                 ||..|.|.:......|     ||.|. |||
Zfish   258 -----VHGECEYPSNLSPPTC-----SCHSG-FIG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 15/39 (38%)
KAZAL_FS 654..687 CDD:238052 11/32 (34%)
KAZAL_FS 723..767 CDD:238052 12/38 (32%)
tmeff2bXP_005165802.1 KAZAL 91..136 CDD:197624 18/46 (39%)
KAZAL 185..231 CDD:197624 14/56 (25%)
PHA02887 <245..285 CDD:333467 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.