Sequence 1: | NP_652376.2 | Gene: | Fs / 2768836 | FlyBaseID: | FBgn0259878 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001296373.1 | Gene: | SPARC / 6678 | HGNCID: | 11219 | Length: | 341 | Species: | Homo sapiens |
Alignment Length: | 243 | Identity: | 52/243 - (21%) |
---|---|---|---|
Similarity: | 78/243 - (32%) | Gaps: | 90/243 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 605 KNSCSGVHCLNGLTCVEDQYLMPHCIACR--IECPWDNLDVDSSGYDERQAVCGVDGKTYRSACD 667
Fly 668 INRMIC-----KIGRSIAVAYPGPCRAGRVSCADIKCGP-----KD---NCLVDLQTRQP--RCV 717
Fly 718 TCRYKCPRKQ-----------QRPVHKICGYNNQTYNSWC--------EMHKH------------ 751
Fly 752 ----------SCESRYF-------------------IGVKS---QGSC 767 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fs | NP_652376.2 | KAZAL | 564..604 | CDD:197624 | |
KAZAL_FS | 654..687 | CDD:238052 | 12/37 (32%) | ||
KAZAL_FS | 723..767 | CDD:238052 | 13/106 (12%) | ||
SPARC | NP_001296373.1 | FSL_SPARC | 71..152 | CDD:238649 | 26/90 (29%) |
SPARC_Ca_bdg | 153..287 | CDD:287550 | 19/133 (14%) | ||
SPARC_EC | 154..290 | CDD:238155 | 19/135 (14%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4004 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |