DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and SPARC

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001296373.1 Gene:SPARC / 6678 HGNCID:11219 Length:341 Species:Homo sapiens


Alignment Length:243 Identity:52/243 - (21%)
Similarity:78/243 - (32%) Gaps:90/243 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 KNSCSGVHCLNGLTCVEDQYLMPHCIACR--IECPWDNLDVDSSGYDERQAVCGVDGKTYRSACD 667
            :|.|...||.:|..|..|:...|.|: |:  ..||        :...|.:.||..|.||:.|:|.
Human    69 ENPCQNHHCKHGKVCELDENNTPMCV-CQDPTSCP--------APIGEFEKVCSNDNKTFDSSCH 124

  Fly   668 INRMIC-----KIGRSIAVAYPGPCRAGRVSCADIKCGP-----KD---NCLVDLQTRQP--RCV 717
            .....|     |.|..:.:.|.|||:. ...|.|.:...     :|   |.||.|..|..  ..:
Human   125 FFATKCTLEGTKKGHKLHLDYIGPCKY-IPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLL 188

  Fly   718 TCRYKCPRKQ-----------QRPVHKICGYNNQTYNSWC--------EMHKH------------ 751
            |.:.|...|:           ..||..:.....:.||.:.        ::.:|            
Human   189 TEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELA 253

  Fly   752 ----------SCESRYF-------------------IGVKS---QGSC 767
                      .|.:|:|                   .|:|.   ||||
Human   254 PLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQRYRQGSC 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624
KAZAL_FS 654..687 CDD:238052 12/37 (32%)
KAZAL_FS 723..767 CDD:238052 13/106 (12%)
SPARCNP_001296373.1 FSL_SPARC 71..152 CDD:238649 26/90 (29%)
SPARC_Ca_bdg 153..287 CDD:287550 19/133 (14%)
SPARC_EC 154..290 CDD:238155 19/135 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4004
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.